PDB entry 6fbl

View 6fbl on RCSB PDB site
Description: nmr solution structure of mina-1(254-334)
Deposited on 2017-12-19, released 2019-01-30
The last revision was dated 2019-09-18, with a file datestamp of 2019-09-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mina-1
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: C41G7.3, CELE_C41G7.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93367 (5-85)
      • expression tag (0-4)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6fblA (A:)
sgshmktcvvekikqwipttevgkilgnraavkkhierqfncvitvhtevqssfgatpve
ivaqnkeqcqearnavmslmqshqdk