PDB entry 6fbj

View 6fbj on RCSB PDB site
Description: monoclonal antibody targeting Matrix metalloproteinase 7
Class: metal binding protein
Keywords: antibody, METAL BINDING PROTEIN
Deposited on 2017-12-19, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: heavy chain
    Species: Escherichia coli K-12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FBJ (0-End)
  • Chain 'L':
    Compound: light chain
    Species: Escherichia coli K-12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FBJ (0-213)
    Domains in SCOPe 2.07: d6fbjl1, d6fbjl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6fbjL (L:)
    divltqspaslavslgqratiscrasesfdsygntfvhwyqqkpgqppklliylvsnles
    gvparfrgrgsrtdftltidpveaddaaiyycqqnnedpytfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwidgserqngvlnswtdqdskdstysmss
    tltltkdeyerhnsytceathktstspivksfnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fbjL (L:)
    divltqspaslavslgqratiscrasesfdsygntfvhwyqqkpgqppklliylvsnles
    gvparfrgrgsrtdftltidpveaddaaiyycqqnnedpytfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwdgserqngvlnswtdqdskdstysmsst
    ltltkdeyerhnsytceathktstspivksfnr