PDB entry 6fb8

View 6fb8 on RCSB PDB site
Description: crystal structure of the i-crei homing endonuclease d75n variant in complex with an altered version of its target dna at 5nnn region in the presence of magnesium
Deposited on 2017-12-18, released 2018-07-18
The last revision was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA endonuclease I-crei
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05725
      • engineered mutation (73)
      • expression tag (152-153)
  • Chain 'B':
    Compound: DNA endonuclease I-crei
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05725 (0-151)
      • engineered mutation (73)
      • expression tag (152)
  • Chain 'C':
    Compound: DNA (5'-d(*tp*cp*ap*ap*ap*ap*cp*tp*gp*cp*gp*tp*ap*cp*gp*ap*cp*gp*tp*tp*tp*tp*gp*a)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'D':
    Compound: DNA (5'-d(*tp*cp*ap*ap*ap*ap*cp*gp*tp*cp*gp*tp*ap*cp*gp*cp*ap*gp*tp*tp*tp*tp*gp*a)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: MG, PGO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6fb8A (A:)
ntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
igvgyvrdrgsvsnyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
flevctwvdqiaalndsktrkttsetvravldaa

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6fb8B (B:)
ntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
igvgyvrdrgsvsnyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
flevctwvdqiaalndsktrkttsetvravldaa

    Sequence, based on observed residues (ATOM records):
    >6fb8B (B:)
ntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
igvgyvrdrgsvsnyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
flevctwvdqiaalndsktrkttsetvravlda

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.