PDB entry 6fb7

View 6fb7 on RCSB PDB site
Description: crystal structure of the i-crei homing endonuclease d75n variant in complex with its target dna in the presence of manganese
Deposited on 2017-12-18, released 2018-07-18
The last revision was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA endonuclease I-crei
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05725 (0-151)
    • engineered mutation (73)
• Chain 'B':
  Compound: DNA endonuclease I-crei
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05725 (0-151)
    • engineered mutation (73)
• Chain 'D':
  Compound: DNA (5'-d(*tp*cp*ap*ap*ap*ap*cp*gp*tp*cp*gp*tp*ap*c)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'E':
  Compound: DNA (5'-d(p*gp*ap*cp*gp*tp*tp*tp*tp*gp*a)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'F':
  Compound: DNA (5'-d(*tp*cp*ap*ap*ap*ap*cp*gp*tp*cp*gp*tp*ap*c)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'G':
  Compound: DNA (5'-d(p*gp*ap*cp*gp*tp*tp*tp*tp*gp*a)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Heterogens: MN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6fb7A (A:)
  ntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
  igvgyvrdrgsvsnyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
  flevctwvdqiaalndsktrkttsetvravld
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >6fb7B (B:)
  ntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
  igvgyvrdrgsvsnyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
  flevctwvdqiaalndsktrkttsetvravld
  

  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.