PDB entry 6fb6
View 6fb6 on RCSB PDB site
Description: crystal structure of a tailored i-crei homing endonuclease protein (3115 variant) in complex with an altered version of its target dna (haemoglobin beta subunit gene) at 5nnn region in the presence of manganese
Deposited on
2017-12-18, released
2018-07-18
The last revision was dated
2018-07-18, with a file datestamp of
2018-07-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: I-CreI monomer A
Species: Chlamydomonas reinhardtii [TaxId:3055]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: I-CreI monomer B
Species: Chlamydomonas reinhardtii [TaxId:3055]
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: DNA (5'-d(*tp*cp*ap*gp*ap*cp*tp*tp*gp*tp*cp*cp*ap*c)-3')
Species: synthetic construct, synthetic [TaxId:32630]
- Chain 'E':
Compound: DNA (5'-d(p*gp*gp*gp*ap*gp*tp*cp*ap*gp*a)-3')
Species: synthetic construct, synthetic [TaxId:32630]
- Chain 'F':
Compound: DNA (5'-d(*tp*cp*tp*gp*ap*cp*tp*cp*cp*tp*gp*tp*gp*g)-3')
Species: synthetic construct, synthetic [TaxId:32630]
- Chain 'G':
Compound: DNA (5'-d(p*ap*cp*ap*ap*gp*tp*cp*tp*gp*a)-3')
Species: synthetic construct, synthetic [TaxId:32630]
- Heterogens: MN, HOH
PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.
- Chain 'A':
Sequence; same for both SEQRES and ATOM records:
>6fb6A (A:)
ntkynkefllylagfvdsdgsiiaqikpnqsvkfkhrlqltfdvtqktqrrwfldklvde
igvgyvadsgsvskyrlseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
flevctwvdqiaalndsktrkttsetvravlds
- Chain 'B':
Sequence; same for both SEQRES and ATOM records:
>6fb6B (B:)
ntkynkefllylagfvdgdgsiiaqikpnqsgkfkhklsltfkvtqktqrrwfldklvde
igvgyvydsgsvsnyylseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
flevctwvdqvaalndsktrkttsetvravldsl
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.
- Chain 'G':
No sequence available.