PDB entry 6fb5

View 6fb5 on RCSB PDB site
Description: crystal structure of a tailored i-crei homing endonuclease protein (3115 variant) in complex with an altered version of its target dna (haemoglobin beta subunit gene) at 5nnn region in the presence of magnesium
Deposited on 2017-12-18, released 2018-07-18
The last revision was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: I-CreI monomer A
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FB5 (0-152)
  • Chain 'B':
    Compound: I-CreI monomer B
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FB5 (0-153)
  • Chain 'D':
    Compound: DNA (5'-d(*tp*cp*ap*gp*ap*cp*tp*tp*gp*tp*cp*cp*ap*cp*ap*gp*gp*ap*gp*tp*cp*ap*gp*a)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'F':
    Compound: DNA (5'-d(*tp*cp*tp*gp*ap*cp*tp*cp*cp*tp*gp*tp*gp*gp*ap*cp*ap*ap*gp*tp*cp*tp*gp*a)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: MG, ACT, PGO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6fb5A (A:)
ntkynkefllylagfvdsdgsiiaqikpnqsvkfkhrlqltfdvtqktqrrwfldklvde
igvgyvadsgsvskyrlseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
flevctwvdqiaalndsktrkttsetvravlds

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6fb5B (B:)
ntkynkefllylagfvdgdgsiiaqikpnqsgkfkhklsltfkvtqktqrrwfldklvde
igvgyvydsgsvsnyylseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
flevctwvdqvaalndsktrkttsetvravldsl

  • Chain 'D':
    No sequence available.

  • Chain 'F':
    No sequence available.