PDB entry 6fb4

View 6fb4 on RCSB PDB site
Description: human kibra c2 domain mutant c771a
Deposited on 2017-12-18, released 2018-05-16
The last revision was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein KIBRA
    Species: Homo sapiens [TaxId:9606]
    Gene: WWC1, KIAA0869
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IX03 (1-128)
      • expression tag (0)
      • engineered mutation (114)
  • Chain 'B':
    Compound: Protein KIBRA
    Species: Homo sapiens [TaxId:9606]
    Gene: WWC1, KIAA0869
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IX03 (1-128)
      • expression tag (0)
      • engineered mutation (114)
  • Heterogens: GOL, PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6fb4A (A:)
sgatriqialkydeknkqfailiiqlsnlsallqqqdqkvnirvavlpcsesttclfrtr
pldasdtlvfnevfwvsmsypalhqktlrvdvcttdrshleeclggaqislaevarsger
strwynlls

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6fb4B (B:)
sgatriqialkydeknkqfailiiqlsnlsallqqqdqkvnirvavlpcsesttclfrtr
pldasdtlvfnevfwvsmsypalhqktlrvdvcttdrshleeclggaqislaevarsger
strwynlls