PDB entry 6fb2

View 6fb2 on RCSB PDB site
Description: crystal structure of a tailored i-crei homing endonuclease protein (3115 variant) in complex with its target dna (haemoglobin beta subunit gene) in the presence of manganese
Deposited on 2017-12-18, released 2018-07-18
The last revision was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA endonuclease I-crei
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05725 (0-152)
    • conflict (17)
    • conflict (31)
    • conflict (36)
    • conflict (38)
    • conflict (42)
    • conflict (66)
    • conflict (68)
    • conflict (73)
    • conflict (75)
• Chain 'B':
  Compound: DNA endonuclease I-crei
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05725 (0-153)
    • conflict (31)
    • conflict (36)
    • conflict (42)
    • conflict (66)
    • conflict (68)
    • conflict (73)
    • conflict (75)
    • conflict (130)
• Chain 'D':
  Compound: DNA (5'-d(*tp*cp*ap*gp*ap*cp*tp*tp*cp*tp*cp*cp*ap*c)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'E':
  Compound: DNA (5'-d(p*ap*gp*gp*ap*gp*tp*cp*ap*gp*a)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'F':
  Compound: DNA (5'-d(*tp*cp*tp*gp*ap*cp*tp*cp*cp*tp*gp*tp*gp*g)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'G':
  Compound: DNA (5'-d(p*ap*gp*ap*ap*gp*tp*cp*tp*gp*a)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Heterogens: MN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6fb2A (A:)
  ntkynkefllylagfvdsdgsiiaqikpnqsvkfkhrlqltfdvtqktqrrwfldklvde
  igvgyvadsgsvskyrlseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
  flevctwvdqiaalndsktrkttsetvravlds
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >6fb2B (B:)
  ntkynkefllylagfvdgdgsiiaqikpnqsgkfkhklsltfkvtqktqrrwfldklvde
  igvgyvydsgsvsnyylseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
  flevctwvdqvaalndsktrkttsetvravldsl
  

  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.