PDB entry 6fb1

View 6fb1 on RCSB PDB site
Description: crystal structure of a tailored i-crei homing endonuclease protein (3115 variant) in complex with its target dna (haemoglobin beta subunit gene) in the presence of magnesium
Deposited on 2017-12-18, released 2018-07-18
The last revision was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 3.02 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA endonuclease I-crei
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FB1 (0-End)
  • Chain 'B':
    Compound: DNA endonuclease I-crei
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FB1 (0-153)
  • Chain 'D':
    Compound: DNA (5'-d(*tp*cp*ap*gp*ap*cp*tp*tp*cp*tp*cp*cp*ap*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'E':
    Compound: DNA (5'-d(p*ap*gp*gp*ap*gp*tp*cp*ap*gp*a)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'F':
    Compound: DNA (5'-d(*tp*cp*tp*gp*ap*cp*tp*cp*cp*tp*gp*tp*gp*g)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'G':
    Compound: DNA (5'-d(p*ap*gp*ap*ap*gp*tp*cp*tp*gp*a)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6fb1A (A:)
    ntkynkefllylagfvdsdgsiiaqikpnqsvkfkhrlqltfdvtqktqrrwfldklvde
    igvgyvadsgsvskyrlseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravldsl
    

    Sequence, based on observed residues (ATOM records):
    >6fb1A (A:)
    ntkynkefllylagfvdsdgsiiaqikpnqsvkfkhrlqltfdvtqktqrrwfldklvde
    igvgyvadsgsvskyrlseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravlds
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6fb1B (B:)
    ntkynkefllylagfvdgdgsiiaqikpnqsgkfkhklsltfkvtqktqrrwfldklvde
    igvgyvydsgsvsnyylseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqvaalndsktrkttsetvravldsl
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.