PDB entry 6faw

View 6faw on RCSB PDB site
Description: crystal structure of c-terminal modified tau peptide-hybrid 4.2c-i with 14-3-3sigma
Deposited on 2017-12-18, released 2018-05-16
The last revision was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN, HME1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (5-235)
      • expression tag (0-4)
  • Chain 'B':
    Compound: ace-arg-thr-pro-sep-leu-pro-gly
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FAW (Start-6)
  • Chain 'C':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN, HME1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (5-235)
      • expression tag (0-4)
  • Chain 'D':
    Compound: thr-pro-sep-leu-pro-gly
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FAW (0-5)
  • Heterogens: CL, MG, NA, D3K, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6fawA (A:)
    gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq
    raawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdae
    srvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglaln
    fsvfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

    Sequence, based on observed residues (ATOM records):
    >6fawA (A:)
    gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq
    raawrvlssieqksgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkm
    kgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyei
    anspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6fawB (B:)
    rtpslpg
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6fawC (C:)
    gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq
    raawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdae
    srvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglaln
    fsvfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

    Sequence, based on observed residues (ATOM records):
    >6fawC (C:)
    gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq
    raawrvlssieqksgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkm
    kgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyei
    anspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >6fawD (D:)
    tpslpg