PDB entry 6fat

View 6fat on RCSB PDB site
Description: the crystal structure of a feruloyl esterase c from fusarium oxysporum.
Deposited on 2017-12-17, released 2019-01-30
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carboxylic ester hydrolase
    Species: Fusarium oxysporum [TaxId:5507]
    Gene: faeC
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Carboxylic ester hydrolase
    Species: Fusarium oxysporum [TaxId:5507]
    Gene: faeC
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6fatA (A:)
    dfaakcagfktslklpntkvwftehvpagknitfpdnhptctpkstitdveicrvamfvt
    tgpksnltleawlpsnwtgrflstgnggmagciqyddvaygagfgfatvgannghngtsa
    vsmyknsgvvedyvyrsvhtgtvlgkeltkkfygkkhtksyylgcstggrqgwkeaqsfp
    ddfdgivagapamrfnglqsrsgsfwgitgppgapthlspeewamvqknvlvqcdepldg
    vadgiledpnlcqyrpealvcskgqtkncltgpqietvrkvfgplygnngtyiyprippg
    adqgfgfaigeqpfpystewfqyviwndtkwdpntigpndyqkasevnpfnvetwegdls
    kfrkrgskiihwhgledglissdnsmeyynhvsatmglsnteldefyryfrvsgcghcsg
    giganrignnranlggkeaknnvllalvkwveegqapetitgvryvngattgkveverrh
    crypyrnvwdrkgnyknpdswkcelpleqkliseedlnsavdhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6fatA (A:)
    dfaakcagfktslklpntkvwftehvpagknitfpdnhptctpkstitdveicrvamfvt
    tgpksnltleawlpsnwtgrflstgnggmagciqyddvaygagfgfatvgannghngtsa
    vsmyknsgvvedyvyrsvhtgtvlgkeltkkfygkkhtksyylgcstggrqgwkeaqsfp
    ddfdgivagapamrfnglqsrsgsfwgitgppgapthlspeewamvqknvlvqcdepldg
    vadgiledpnlcqyrpealvcskgqtkncltgpqietvrkvfgplygnngtyiyprippg
    adqgfgfaigeqpfpystewfqyviwndtkwdpntigpndyqkasevnpfnvetwegdls
    kfrkrgskiihwhgledglissdnsmeyynhvsatmglsnteldefyryfrvsgcghcsg
    giganrignnranlggkeaknnvllalvkwveegqapetitgvryvngattgkveverrh
    crypyrnvwdrkgnyknpdswkcelple
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6fatB (B:)
    dfaakcagfktslklpntkvwftehvpagknitfpdnhptctpkstitdveicrvamfvt
    tgpksnltleawlpsnwtgrflstgnggmagciqyddvaygagfgfatvgannghngtsa
    vsmyknsgvvedyvyrsvhtgtvlgkeltkkfygkkhtksyylgcstggrqgwkeaqsfp
    ddfdgivagapamrfnglqsrsgsfwgitgppgapthlspeewamvqknvlvqcdepldg
    vadgiledpnlcqyrpealvcskgqtkncltgpqietvrkvfgplygnngtyiyprippg
    adqgfgfaigeqpfpystewfqyviwndtkwdpntigpndyqkasevnpfnvetwegdls
    kfrkrgskiihwhgledglissdnsmeyynhvsatmglsnteldefyryfrvsgcghcsg
    giganrignnranlggkeaknnvllalvkwveegqapetitgvryvngattgkveverrh
    crypyrnvwdrkgnyknpdswkcelpleqkliseedlnsavdhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6fatB (B:)
    dfaakcagfktslklpntkvwftehvpagknitfpdnhptctpkstitdveicrvamfvt
    tgpksnltleawlpsnwtgrflstgnggmagciqyddvaygagfgfatvgannghngtsa
    vsmyknsgvvedyvyrsvhtgtvlgkeltkkfygkkhtksyylgcstggrqgwkeaqsfp
    ddfdgivagapamrfnglqsrsgsfwgitgppgapthlspeewamvqknvlvqcdepldg
    vadgiledpnlcqyrpealvcskgqtkncltgpqietvrkvfgplygnngtyiyprippg
    adqgfgfaigeqpfpystewfqyviwndtkwdpntigpndyqkasevnpfnvetwegdls
    kfrkrgskiihwhgledglissdnsmeyynhvsatmglsnteldefyryfrvsgcghcsg
    giganrignnranlggkeaknnvllalvkwveegqapetitgvryvngattgkveverrh
    crypyrnvwdrkgnyknpdswkcelple