PDB entry 6fas

View 6fas on RCSB PDB site
Description: crystal structure of val1 b3 domain in complex with cognate dna
Deposited on 2017-12-17, released 2018-04-18
The last revision was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B3 domain-containing transcription repressor VAL1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: VAL1, HSI2, At2g30470, T6B20.17
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8W4L5 (1-End)
      • initiating methionine (0)
  • Chain 'B':
    Compound: B3 domain-containing transcription repressor VAL1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: VAL1, HSI2, At2g30470, T6B20.17
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8W4L5 (1-End)
      • initiating methionine (0)
  • Chain 'C':
    Compound: DNA (5'-d(*ap*gp*cp*cp*ap*tp*gp*cp*ap*cp*cp*g)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'D':
    Compound: DNA (5'-d(*cp*gp*gp*tp*gp*cp*ap*tp*gp*gp*cp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'E':
    Compound: DNA (5'-d(*ap*gp*cp*cp*ap*tp*gp*cp*ap*cp*cp*g)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'F':
    Compound: DNA (5'-d(*cp*gp*gp*tp*gp*cp*ap*tp*gp*gp*cp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6fasA (A:)
mnlnivplfektlsasdagrigrlvlpkacaeayfppisqsegiplkiqdvrgrewtfqf
rywpnnnsrmyvlegvtpciqsmmlqagdtvtfsrvdpggklimgsrkaanghhhhhhg

    Sequence, based on observed residues (ATOM records):
    >6fasA (A:)
mnlnivplfektlsasdagrigrlvlpkacaeayfppisqsegiplkiqdvrgrewtfqf
rywpnnnsrmyvlegvtpciqsmmlqagdtvtfsrvdpggklimgsrkaa

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6fasB (B:)
mnlnivplfektlsasdagrigrlvlpkacaeayfppisqsegiplkiqdvrgrewtfqf
rywpnnnsrmyvlegvtpciqsmmlqagdtvtfsrvdpggklimgsrkaanghhhhhhg

    Sequence, based on observed residues (ATOM records):
    >6fasB (B:)
mnlnivplfektlsasdagrigrlvlpkacaeayfppisqsegiplkiqdvrgrewtfqf
rywpnnnsrmyvlegvtpciqsmmlqagdtvtfsrvdpggklimgsrkaa

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.