PDB entry 6fap

View 6fap on RCSB PDB site
Description: Crystal structure of human BAZ2A PHD zinc finger in complex with Fr23
Class: transcription
Keywords: transcription
Deposited on 2017-12-16, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain adjacent to zinc finger domain protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2A, KIAA0314, TIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fapa_
  • Chain 'B':
    Compound: Bromodomain adjacent to zinc finger domain protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2A, KIAA0314, TIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fapb_
  • Chain 'C':
    Compound: Bromodomain adjacent to zinc finger domain protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2A, KIAA0314, TIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fapc_
  • Chain 'D':
    Compound: Bromodomain adjacent to zinc finger domain protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2A, KIAA0314, TIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fapd_
  • Heterogens: ZN, PO4, D3H, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fapA (A:)
    hmsvnkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fapA (A:)
    kvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fapB (B:)
    hmsvnkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fapB (B:)
    kvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6fapC (C:)
    hmsvnkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fapC (C:)
    kvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6fapD (D:)
    hmsvnkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fapD (D:)
    kvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv