PDB entry 6fal

View 6fal on RCSB PDB site
Description: Tryptophan Repressor TrpR from E.coli with 3-Indolepropionic acid as ligand
Class: transcription
Keywords: Ligand Binding, TRANSCRIPTION
Deposited on 2017-12-15, released 2019-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trp operon repressor
    Species: Escherichia coli [TaxId:562]
    Gene: trpR, rtrY, b4393, JW4356
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A881
      • conflict (86)
    Domains in SCOPe 2.08: d6fala_
  • Chain 'B':
    Compound: trp operon repressor
    Species: Escherichia coli [TaxId:562]
    Gene: trpR, rtrY, b4393, JW4356
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A881 (Start-106)
      • conflict (86)
      • expression tag (107)
    Domains in SCOPe 2.08: d6falb1, d6falb2
  • Heterogens: IOP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6falA (A:)
    aqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveel
    lrgemsqrelknelgagiatitrgsnylkaapvelrqwleevllksdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6falA (A:)
    amaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellrgemsqr
    elknelgagiatitrgsnylkaapvelrqwleevllk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6falB (B:)
    aqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveel
    lrgemsqrelknelgagiatitrgsnylkaapvelrqwleevllksdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6falB (B:)
    eqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellrgemsqrelk
    nelgagiatitrgsnylkaapvelrqwleevllksdl