PDB entry 6fae

View 6fae on RCSB PDB site
Description: The Sec7 domain of IQSEC2 (Brag1) in complex with the small GTPase Arf1
Class: hydrolase
Keywords: GTPase GEF, HYDROLASE
Deposited on 2017-12-15, released 2018-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IQ motif and SEC7 domain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: IQSEC2, KIAA0522
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ADP-ribosylation factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84077 (49-End)
      • expression tag (43-48)
    Domains in SCOPe 2.07: d6faeb1, d6faeb2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6faeB (B:)
    mssgaswshpqfekgggsgggsggsawshpqfekgsgvdlgtenlyfqsmrilmvgldaa
    gkttilyklklgeivttiptigfnvetveyknisftvwdvggqdkirplwrhyfqntqgl
    ifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaaeitdklglhsl
    rhrnwyiqatcatsgdglyegldwlsnqlrnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6faeB (B:)
    nlyfqsmrilmvgldaagkttilyklktiptigfnvetveyknisftvwdvggqdkirpl
    wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqnamnaaeit
    dklglhslrhrnwyiqatcatsgdglyegldwlsnql