PDB entry 6fab

View 6fab on RCSB PDB site
Description: three-dimensional structure of murine anti-p-azophenylarsonate fab 36-71. 1. x-ray crystallography, site-directed mutagenesis, and modeling of the complex with hapten
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1991-01-17, released 1993-01-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.209
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg1-kappa 36-71 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6FAB (0-221)
    Domains in SCOPe 2.01: d6fabh1, d6fabh2
  • Chain 'L':
    Compound: igg1-kappa 36-71 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d6fabl1, d6fabl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fabH (H:)
    evqlqqsgvelvragssvkmsckasgytftsnginwvkqrpgqglewigynnpgngyiay
    nekfkgkttltvdkssstaymqlrsltsedsavyfcarseyyggsykfdywgqgttltvs
    sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fabL (L:)
    diqmtqipsslsaslgdrvsiscrasqdinnflnwyqqkpdgtiklliyftsrsqsgvps
    rfsgsgsgtdysltisnleqediatyfcqqgnalprtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec