PDB entry 6fab

View 6fab on RCSB PDB site
Description:
Deposited on 1991-01-17, released 1993-01-15
The last revision prior to the SCOP 1.65 freeze date was dated 1995-05-15, with a file datestamp of 1995-06-03.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.209
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d6fabh1, d6fabh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d6fabl1, d6fabl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fabH (H:)
    evqlqqsgvelvragssvkmsckasgytftsnginwvkqrpgqglewigynnpgngyiay
    nekfkgkttltvdkssstaymqlrsltsedsavyfcarseyyggsykfdywgqgttltvs
    sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fabL (L:)
    diqmtqipsslsaslgdrvsiscrasqdinnflnwyqqkpdgtiklliyftsrsqsgvps
    rfsgsgsgtdysltisnleqediatyfcqqgnalprtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec