PDB entry 6f9w

View 6f9w on RCSB PDB site
Description: Crystal structure of the LSM domain of LSM14 in complex with a C-terminal peptide of 4E-T
Class: rna
Keywords: mRNA turnover, translational repression, decapping, RNA
Deposited on 2017-12-15, released 2018-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein LSM14 homolog A
    Species: Homo sapiens [TaxId:9606]
    Gene: LSM14A, C19orf13, FAM61A, RAP55, RAP55A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6f9wa_
  • Chain 'B':
    Compound: eukaryotic translation initiation factor 4e transporter
    Species: Homo sapiens [TaxId:9606]
    Gene: EIF4ENIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NRA8 (5-36)
      • engineered mutation (14)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6f9wA (A:)
snamsggtpyigskisliskaeiryegilytidtenstvalakvrsfgtedrptdrpipp
rdevfeyiifrgsdikdltvceppkpq

    Sequence, based on observed residues (ATOM records): (download) 
    >6f9wA (A:)
tpyigskisliskaeiryegilytidtenstvalakvrsfgtedrptdrpipprdevfey
iifrgsdikdltvc

  • Chain 'B':
    No sequence available.