PDB entry 6f9u

View 6f9u on RCSB PDB site
Description: Crystal structure of human testis Angiotensin-1 converting enzyme in complex with Sampatrilat-Asp.
Class: hydrolase
Keywords: Angiotensin-1 converting enzyme, ACE inhibitor, Sampatrilat, Sampatrilat-Asp, HYDROLASE
Deposited on 2017-12-15, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiotensin-converting enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: ACE, DCP, DCP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12821
      • conflict (27)
      • conflict (53)
      • conflict (118)
      • conflict (300)
      • conflict (549)
    Domains in SCOPe 2.07: d6f9ua_
  • Heterogens: NAG, BMA, FUC, MAN, ZN, CL, 1PE, D0W, BO3, IMD, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f9uA (A:)
    lvtdeaeaskfveeydrtsqvvwneyaganwnyntnittetskillqknmqiaqhtlkyg
    tqarkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpqg
    sclqlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvda
    gdswrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllg
    nmwaqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefw
    qksmlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykd
    lpvalreganpgfheaigdvlalsvstpkhlhslnllsseggsdehdinflmkmaldkia
    fipfsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhips
    svpyiryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpe
    amqlitgqpqmsasamlsyfkplldwlrtenelhgeklgwpqynwtpnsar
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f9uA (A:)
    deaeaskfveeydrtsqvvwneyaganwnyntnittetskillqknmqiaqhtlkygtqa
    rkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpqgscl
    qlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvdagds
    wrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmw
    aqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwqks
    mlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykdlpv
    alreganpgfheaigdvlalsvstpkhlhslnllsseggsdehdinflmkmaldkiafip
    fsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssvp
    yiryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamq
    litgqpqmsasamlsyfkplldwlrtenelhgeklgwpqynwtpns