PDB entry 6f9s

View 6f9s on RCSB PDB site
Description: Crystal structure of the C-terminal RecA domain of DDX6 in complex with a conserved peptide from LSM14
Class: rna
Keywords: mRNA turnover, translational repression, decapping, RNA
Deposited on 2017-12-15, released 2018-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 3.03 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable ATP-dependent RNA helicase ddx6
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX6, HLR2, RCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6f9sa_
  • Chain 'B':
    Compound: Cytokinesis, Apoptosis, RNA-associated
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: car-1, CELE_Y18D10A.17, Y18D10A.17
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XW17 (5-89)
      • expression tag (1-4)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6f9sA (A:)
snameeltlkgvtqyyayvterqkvhclntlfsrlqinqsiifcnssqrvellakkisql
gyscfyihakmrqehrnrvfhdfrnglcrnlvctdlftrgidiqavnvvinfdfpklaet
ylhrigrsgrfghlglainlityddrfnlksieeqlgteikpipsnidksly

    Sequence, based on observed residues (ATOM records): (download) 
    >6f9sA (A:)
eltlkgvtqyyayvterqkvhclntlfsrlqinqsiifcnssqrvellakkisqlgyscf
yihakmrqehrnrvfhdfrnglcrnlvctdlftrgidiqavnvvinfdfpklaetylhri
grsgrfghlglainlityddrfnlksieeqlgteikpipsnidksly

  • Chain 'B':
    No sequence available.