PDB entry 6f9o

View 6f9o on RCSB PDB site
Description: Crystal structure of cold-adapted haloalkane dehalogenase DpcA from Psychrobacter cryohalolentis K5
Class: hydrolase
Keywords: Microbial enzymes, haloalkane dehalogenases, HLDs, Alpha/Beta-hydrolase fold enzymes, HYDROLASE, 2 domains, the highest activity towards 1-bromobutane, 1-bromohexane and 1, 3-dibromopropane
Deposited on 2017-12-15, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: haloalkane dehalogenase
  Species: Psychrobacter cryohalolentis (strain K5) [TaxId:335284]
  Gene: dhmA, Pcryo_1253
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q1QBB9 (0-302)
    • expression tag (303-308)
  Domains in SCOPe 2.07: d6f9oa1, d6f9oa2
• Heterogens: CL, PEG, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6f9oA (A:)
  mkilrtpdsrfanlpdynfdphylmvddsedselrvhyldegprdadpvlllhgepswcy
  lyrkmipiltaaghrviapdlpgfgrsdkpasrtdytyqrhvnwmqsvldqldlnnitlf
  cqdwggliglrlvaenpdrfarvaagntmlptgdhdlgegfrkwqqfsqeipqfhvggti
  ksgtvtklsqavidaynapfpdesykegarqfpllvpstpddpasennraawielskwtk
  pfitlfsdsdpvtaggdrimqkiipgtkgqahttiangghflqedqgekvakllvqfihd
  nprhhhhhh