PDB entry 6f9o

View 6f9o on RCSB PDB site
Description: Crystal structure of cold-adapted haloalkane dehalogenase DpcA from Psychrobacter cryohalolentis K5
Class: hydrolase
Keywords: Microbial enzymes, haloalkane dehalogenases, HLDs, Alpha/Beta-hydrolase fold enzymes, HYDROLASE, 2 domains, the highest activity towards 1-bromobutane, 1-bromohexane and 1, 3-dibromopropane
Deposited on 2017-12-15, released 2019-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: haloalkane dehalogenase
    Species: Psychrobacter cryohalolentis (strain K5) [TaxId:335284]
    Gene: dhmA, Pcryo_1253
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QBB9 (0-302)
      • expression tag (303-308)
    Domains in SCOPe 2.08: d6f9oa1, d6f9oa2
  • Heterogens: CL, PEG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f9oA (A:)
    mkilrtpdsrfanlpdynfdphylmvddsedselrvhyldegprdadpvlllhgepswcy
    lyrkmipiltaaghrviapdlpgfgrsdkpasrtdytyqrhvnwmqsvldqldlnnitlf
    cqdwggliglrlvaenpdrfarvaagntmlptgdhdlgegfrkwqqfsqeipqfhvggti
    ksgtvtklsqavidaynapfpdesykegarqfpllvpstpddpasennraawielskwtk
    pfitlfsdsdpvtaggdrimqkiipgtkgqahttiangghflqedqgekvakllvqfihd
    nprhhhhhh