PDB entry 6f9m

View 6f9m on RCSB PDB site
Description: The LIPY/F-motif in an intracellular subtilisin protease is involved in inhibition
Class: hydrolase
Keywords: ISP, LIPY/F-motif, subtilisin, protease structure, hydrolase
Deposited on 2017-12-14, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine protease
    Species: Planococcus plakortidis [TaxId:1038856]
    Gene: BBI15_13285
    Database cross-references and differences (RAF-indexed):
    • PDB 6F9M
    Domains in SCOPe 2.07: d6f9ma_
  • Chain 'B':
    Compound: serine protease
    Species: Planococcus plakortidis [TaxId:1038856]
    Gene: BBI15_13285
    Database cross-references and differences (RAF-indexed):
    • PDB 6F9M
    Domains in SCOPe 2.07: d6f9mb_
  • Heterogens: PGE, NA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f9mA (A:)
    mknihlipyrveqvtaappripegvrmiqapelwesaehgkgnvvavldtgcqtdhpdlt
    ariaggrnfthddggdperfedynghgthvagtvaaslrdeegvvgvapladllvvkvld
    kegsgsyegiiagihyaidwrgpegqkttvismslggpedhpelyeavkravdagipvic
    aagnegddahdtdefaypgaygeviqvgavdfdrriapfsntnneidlvapginiystyl
    egkyaslsgtsmatphvsgalalirniserefdrelteaelyaqlvrrtiplgypktaeg
    ngllaldilnkfeqlfkilsnsyangldra
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f9mA (A:)
    nihlipyrveqvtaappripegvrmiqapelwesaehgkgnvvavldtgcqtdhpdltar
    iaggrnfthddggdperfedynghgthvagtvaaslrdeegvvgvapladllvvkvldke
    gsgsyegiiagihyaidwrgpegqkttvismslggpedhpelyeavkravdagipvicaa
    gtdefaypgaygeviqvgavdfdrrineidlvapginiystylegkyaslsgtsmatphv
    sgalalirniserefdrelteaelyaqlvrrtiplgypktaegngllaldiln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6f9mB (B:)
    mknihlipyrveqvtaappripegvrmiqapelwesaehgkgnvvavldtgcqtdhpdlt
    ariaggrnfthddggdperfedynghgthvagtvaaslrdeegvvgvapladllvvkvld
    kegsgsyegiiagihyaidwrgpegqkttvismslggpedhpelyeavkravdagipvic
    aagnegddahdtdefaypgaygeviqvgavdfdrriapfsntnneidlvapginiystyl
    egkyaslsgtsmatphvsgalalirniserefdrelteaelyaqlvrrtiplgypktaeg
    ngllaldilnkfeqlfkilsnsyangldra
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f9mB (B:)
    nihlipyrveqvtaappripegvrmiqapelwesaehgkgnvvavldtgcqtdhpdltar
    iaggrnfthddggdperfedynghgthvagtvaaslrdeegvvgvapladllvvkvldke
    gsgsyegiiagihyaidwrgpegqkttvismslggpedhpelyeavkravdagipvicaa
    gdefaypgaygeviqvgavdfdrrianneidlvapginiystylegkyaslsgtsmatph
    vsgalalirniserefdrelteaelyaqlvrrtiplgypktaegngllaldiln