PDB entry 6f9k

View 6f9k on RCSB PDB site
Description: Tryptophan Repressor TrpR from E.coli with 5-methyl-L-tryptophan as ligand
Class: transcription
Keywords: Ligand Binding, TRANSCRIPTION
Deposited on 2017-12-14, released 2019-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trp operon repressor
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: trpR, rtrY, b4393, JW4356
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A881 (Start-106)
      • expression tag (107)
    Domains in SCOPe 2.08: d6f9ka1, d6f9ka2
  • Heterogens: D0Q, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6f9kA (A:)
maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvrivee
llrgemsqrelknelgagiatitrgsnslkaapvelrqwleevllksdlehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >6f9kA (A:)
qqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveell
rgemsqrelknelgagiatitrgsnslkaapvelrqwleevllksd