PDB entry 6f99

View 6f99 on RCSB PDB site
Description: solution structure of the mrh domain of yos9
Deposited on 2017-12-14, released 2019-01-30
The last revision was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ER quality-control lectin
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YOS9, SCKG_0443
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6f99A (A:)
    gasnsektalltktlnqgvktifdklnercifyqagfwiyeycpgiefvqfhgrvntktg
    eivnrdeslvyrlgkpkanveerefellyddvgyyiseiigsgdicdvtgaermveiqyv
    cggsnsgpstiqwvretkicvyeaqvtipelcnlellakned