PDB entry 6f98

View 6f98 on RCSB PDB site
Description: solution structure of the ring domain of the e3 ubiquitin ligase hrd1
Deposited on 2017-12-14, released 2019-01-30
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: e3 ubiquitin-protein ligase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HRD1, SCKG_1066
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6f98A (A:)
gaeqlqnsanddniciicmdelihspnqqtwknknkkpkrlpcghilhlsclknwmersq
tcpicrlpvfdekgnvvq