PDB entry 6f96

View 6f96 on RCSB PDB site
Description: Crystal Structure of E. coli GyraseB 24kDa in complex with 6-[(ethylcarbamoyl)amino]-4-[(4-methoxyphenyl)amino]-N-(pyridin-3-yl)pyridine-3-carboxamide
Class: isomerase
Keywords: Binding Sites, DNA Gyrase, inhibitors, pyridine-3-carboxamides, topoisomerase IV, ISOMERASE
Deposited on 2017-12-14, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA gyrase subunit b
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: gyrB, Z5190, ECs4634
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f96a_
  • Heterogens: D0K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f96A (A:)
    smsnsydsssikvlkgldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckei
    ivtihadnsvsvqddgrgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvg
    vsvvnalsqklelviqregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnv
    tefeyeilakrlrelsflnsgvsirlrdkrdgkedhfhyeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f96A (A:)
    gldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihadnsvsvqdd
    grgiptgihpeegvsaaevimtvlgvgvsvvnalsqklelviqregkihrqiyehgvpqa
    plavtgetektgtmvrfwpsletftnvtefeyeilakrlrelsflnsgvsirlrdkrdgk
    edhfhye