PDB entry 6f93

View 6f93 on RCSB PDB site
Description: Helicobacter pylori serine hydroxymethyl transferase in apo form
Class: transferase
Keywords: SHMT, METHYLTRANSFERASE, H. pylori folate-sensitive fragile sites, folate cycle, TRANSFERASE
Deposited on 2017-12-13, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine hydroxymethyltransferase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: glyA, HP_0183
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f93a_
  • Chain 'B':
    Compound: serine hydroxymethyltransferase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: glyA, HP_0183
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f93b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f93A (A:)
    mayfleqtdseifelifeeykrqnehlemiasenytfasvmeamgsvltnkyaegypnkr
    yyggcevvdkieslaierakklfncqfanvqahsgsqannavyhallkpydkilgmdlsc
    gghlthgakvsltgkhyqsfsygvnldgyidyeealkiaqsvkpeiivcgfsaypreidf
    kkfreiadevgalllgdiahvaglvvtgehahpfphchvvsstthktlrgprggiiltnd
    eeiaakidkaifpgtqggplmhviaakavgfkenlkpefkayaqlvksnmqvlakalkek
    nhklvsggtsnhlllmdfldkpysgkdadialgnagitvnkntipgetrspfvtsgirig
    saalsargmgakefeiignkisdilndinnvslqlhvkeelkamvnqfpvyhqpifrshh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f93A (A:)
    fleqtdseifelifeeykrqnehlemiasenytfasvmeamgsvltnkyvvdkieslaie
    rakklfncqfanvqahsgsqannavyhallkpydkilgmdlscgghsltgkhyqsfsygv
    nldgyidyeealkiaqsvkpeiivcgfsaypreidfkkfreiadevgalllgdiahvagl
    vvtgehahpfphchvvsstthktlrgprggiiltndeeiaakidkaifpgtqggplmhvi
    aakavgfkenlkpefkayaqlvksnmqvlakalkeknhklvsggtsnhlllmdfldkpys
    gkdadialgnagitvnkntipgetrspfvtsgirigsaalsargmgakefeiignkisdi
    lndinnvslqlhvkeelkamvnqfpvy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6f93B (B:)
    mayfleqtdseifelifeeykrqnehlemiasenytfasvmeamgsvltnkyaegypnkr
    yyggcevvdkieslaierakklfncqfanvqahsgsqannavyhallkpydkilgmdlsc
    gghlthgakvsltgkhyqsfsygvnldgyidyeealkiaqsvkpeiivcgfsaypreidf
    kkfreiadevgalllgdiahvaglvvtgehahpfphchvvsstthktlrgprggiiltnd
    eeiaakidkaifpgtqggplmhviaakavgfkenlkpefkayaqlvksnmqvlakalkek
    nhklvsggtsnhlllmdfldkpysgkdadialgnagitvnkntipgetrspfvtsgirig
    saalsargmgakefeiignkisdilndinnvslqlhvkeelkamvnqfpvyhqpifrshh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f93B (B:)
    yfleqtdseifelifeeykrqnehlemiasenytfasvmeamgsvltnkyavdkieslai
    erakklfncqfanvqahsgsqannavyhallkpydkilgmdlskhyqsfsygvnldgyid
    yeealkiaqsvkpeiivcgfsaypreidfkkfreiadevgalllgdiahvaglvvtgeha
    hpfphchvvsstthktlrgprggiiltndeeiaakidkaifpgtqggplmhviaakavgf
    kenlkpefkayaqlvksnmqvlakalkeknhklvsggtsnhlllmdfldkpysgkdadia
    lgnagitvnkntipgetrspfvtsgirigsaalsargmgakefeiignkisdilndinnv
    slqlhvkeelkamvnqfpvyhqpif