PDB entry 6f8h

View 6f8h on RCSB PDB site
Description: antitoxin GraA
Class: antitoxin
Keywords: GraA, HigA, antitoxin
Deposited on 2017-12-13, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: XRE family transcriptional regulator
    Species: Pseudomonas putida [TaxId:303]
    Gene: AYO08_18510
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f8ha_
  • Chain 'B':
    Compound: XRE family transcriptional regulator
    Species: Pseudomonas putida [TaxId:303]
    Gene: AYO08_18510
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f8hb_
  • Chain 'C':
    Compound: XRE family transcriptional regulator
    Species: Pseudomonas putida [TaxId:303]
    Gene: AYO08_18510
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f8hc_
  • Chain 'D':
    Compound: XRE family transcriptional regulator
    Species: Pseudomonas putida [TaxId:303]
    Gene: AYO08_18510
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f8hd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f8hA (A:)
    mhhhhhhlkngmrpihpgeilreefqkemgfsaaalaralgvatptvnnilrerggvsad
    malrlsicldttpefwlnlqtafdlrtaeqqhgdeiigsvqrlva
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f8hA (A:)
    ngmrpihpgeilreefqkemgfsaaalaralgvatptvnnilrerggvsadmalrlsicl
    dttpefwlnlqtafdlrtaeqqhgdeiigsvqrlva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6f8hB (B:)
    mhhhhhhlkngmrpihpgeilreefqkemgfsaaalaralgvatptvnnilrerggvsad
    malrlsicldttpefwlnlqtafdlrtaeqqhgdeiigsvqrlva
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f8hB (B:)
    mrpihpgeilreefqkemgfsaaalaralgvatptvnnilrerggvsadmalrlsicldt
    tpefwlnlqtafdlrtaeqqhgdeiigsvqrlva
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6f8hC (C:)
    mhhhhhhlkngmrpihpgeilreefqkemgfsaaalaralgvatptvnnilrerggvsad
    malrlsicldttpefwlnlqtafdlrtaeqqhgdeiigsvqrlva
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f8hC (C:)
    gmrpihpgeilreefqkemgfsaaalaralgvatptvnnilrerggvsadmalrlsicld
    ttpefwlnlqtafdlrtaeqqhgdeiigsvqrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6f8hD (D:)
    mhhhhhhlkngmrpihpgeilreefqkemgfsaaalaralgvatptvnnilrerggvsad
    malrlsicldttpefwlnlqtafdlrtaeqqhgdeiigsvqrlva
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f8hD (D:)
    mrpihpgeilreefqkemgfsaaalaralgvatptvnnilrerggvsadmalrlsicldt
    tpefwlnlqtafdlrtaeqqhgdeiigsvqrlva