PDB entry 6f8e

View 6f8e on RCSB PDB site
Description: ph domain from tgaph
Deposited on 2017-12-13, released 2019-01-30
The last revision was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pleckstrin homology domain
    Species: Toxoplasma gondii (strain ATCC 50611 / Me49) [TaxId:508771]
    Gene: TGME49_249970
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6f8eA (A:)
sasdirmkkvmqyrraltkvvklkthlfsetvkvtcskdgeevqwfkgkstagaqdrkkp
sggfpvdkitsvksqadntkvlvitvnnpqpttynftfkspgereswqeqiqslmkfmsm
k