PDB entry 6f8b

View 6f8b on RCSB PDB site
Description: LasB bound to thiol based inhibitor
Class: hydrolase
Keywords: LasB, inhibitor, hydrolase
Deposited on 2017-12-12, released 2018-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elastase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f8ba_
  • Heterogens: CA, ZN, CXH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f8bA (A:)
    aeaggpggnqkigkytygsdygplivndrcemddgnvitvdmnsstddskttpfrfacpt
    ntykqvngaysplndahffggvvfklyrdwfgtsplthklymkvhygrsvenaywdgtam
    lfgdgatmfyplvsldvaahevshgfteqnsgliyrgqsggmneafsdmageaaefymrg
    kndfligydikkgsgalrymdqpsrdgrsidnasqyyngidvhhssgvynrafyllansp
    gwdtrkafevfvdanryywtatsnynsgacgvirsaqnrnysaadvtrafstvgvtcpsa
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f8bA (A:)
    aeaggpggnqkigkytygsdygplivndrcemddgnvitvdmnsstddskttpfrfacpt
    ntykqvngaysplndahffggvvfklyrdwfgtsplthklymkvhygrsvenaywdgtam
    lfgdgatmfyplvsldvaahevshgfteqnsgliyrgqsggmneafsdmageaaefymrg
    kndfligydikkgsgalrymdqpsrdgrsidnasqyyngidvhhssgvynrafyllansp
    gwdtrkafevfvdanryywtatsnynsgacgvirsaqnrnysaadvtrafstvgvtcp