PDB entry 6f7x

View 6f7x on RCSB PDB site
Description: crystal structure of dimethylated rsl - cucurbit[7]uril complex, f432 form
Deposited on 2017-12-12, released 2018-05-30
The last revision was dated 2020-08-05, with a file datestamp of 2020-07-31.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: fucose-binding lectin protein
  Species: Ralstonia solanacearum [TaxId:305]
  Gene: RSP795_21825, RSP799_05830, RUN39_v1_50103
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0S4TLR1 (0-89)
• Chain 'B':
  Compound: fucose-binding lectin protein
  Species: Ralstonia solanacearum [TaxId:305]
  Gene: RSP795_21825, RSP799_05830, RUN39_v1_50103
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0S4TLR1 (0-89)
• Chain 'C':
  Compound: fucose-binding lectin protein
  Species: Ralstonia solanacearum [TaxId:305]
  Gene: RSP795_21825, RSP799_05830, RUN39_v1_50103
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0S4TLR1 (0-89)
• Heterogens: MFU, QQ7, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6f7xA (A:)
  xsvqtaatswgtvpsirvytanngkitercwdgkgwytgafnepgdnvsvtswlvgsaih
  irvyastgttttewcwdgngwtkgaytatn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >6f7xB (B:)
  xsvqtaatswgtvpsirvytanngkitercwdgkgwytgafnepgdnvsvtswlvgsaih
  irvyastgttttewcwdgngwtkgaytatn
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >6f7xC (C:)
  xsvqtaatswgtvpsirvytanngkitercwdgkgwytgafnepgdnvsvtswlvgsaih
  irvyastgttttewcwdgngwtkgaytatn