PDB entry 6f7k

View 6f7k on RCSB PDB site
Description: crystal structure of dettilon tailspike protein (gp208)
Deposited on 2017-12-11, released 2018-12-19
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tailspike
    Species: Salmonella phage Det7 [TaxId:454798]
    Gene: 208, DET7_208
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Tailspike
    Species: Salmonella phage Det7 [TaxId:454798]
    Gene: 208, DET7_208
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0C5PVE3 (1-546)
      • initiating methionine (0)
  • Chain 'C':
    Compound: Tailspike
    Species: Salmonella phage Det7 [TaxId:454798]
    Gene: 208, DET7_208
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0C5PVE3 (1-546)
      • initiating methionine (0)
  • Chain 'D':
    Compound: Tailspike
    Species: Salmonella phage Det7 [TaxId:454798]
    Gene: 208, DET7_208
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0C5PVE3 (1-546)
      • initiating methionine (0)
  • Chain 'F':
    Compound: Tailspike
    Species: Salmonella phage Det7 [TaxId:454798]
    Gene: 208, DET7_208
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0C5PVE3 (1-546)
      • initiating methionine (0)
  • Chain 'G':
    Compound: Tailspike
    Species: Salmonella phage Det7 [TaxId:454798]
    Gene: 208, DET7_208
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0C5PVE3 (1-546)
      • initiating methionine (0)
  • Heterogens: EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6f7kA (A:)
    mlrgelnnegvinfshadtygndsvgahlqnvvyptdapfnaatdgttdttvaiksaiah
    ciskgkklvlnhlfmitdtlvisdglhvecltsdsgvksdvpagkfavkitgansgwfgg
    kilgknlpesttvrqdgvlfdenaeycfitgtevtgffakglhtsdadgvgygiydkgyg
    tliskcyanskfcvalggtegrvlknritnnyltsgeakpwswasnywdgivsenahryv
    iafndvsacgqsgiyfggnggystdniivnntvyacwnrgidmglfseksatndvlrnii
    kgnntynnrenniwlagvsncsvvgntswfdtnydvifagypgghicislasgangeacv
    gntidsntcidprgnagitvptgatgnvfgsgnnlsqagaiyiaspdlitsnrfelavtg
    sftpvllpesgsitlsssstgvfratgnridfsvtvnvssisspsgnlniaylpgmsgkt
    sstsmfiidywndltlssgviplaslnlenqdqitvyrtdggrvlydfsslmkstssfil
    kgfvdfn
    

    Sequence, based on observed residues (ATOM records):
    >6f7kA (A:)
    lrgelnnegvinfshadtygndsvgahlqnvvyptdapfnaatdgttdttvaiksaiahc
    iskgkklvlnhlfmitdtlvisdglhvecltsdsgvksdvpagkfavkitgansgwfggk
    ilgknlpesttvrqdgvlfdenaeycfitgtevtgffakglhtsdadgvgygiydkgygt
    liskcyanskfcvalggtegrvlknritnnyltsgeakpwswasnywdgivsenahryvi
    afndvsacgqsgiyfggnggystdniivnntvyacwnrgidmglfseksatndvlrniik
    gnntynnrenniwlagvsncsvvgntswfdtnydvifagypgghicislasgangeacvg
    ntidsntcidprgnagitvptgatgnvfgsgnnlsqagaiyiaspdlitsnrfelavtgs
    ftpvllpesgsitlsssstgvfratgnridfsvtvnvssisspsgnlniaylpgmsgkts
    stsmfiidywndltlssgviplaslnlenqdqitvyrtdggrvlydfsslmkstssfilk
    gfvdfn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6f7kB (B:)
    mlrgelnnegvinfshadtygndsvgahlqnvvyptdapfnaatdgttdttvaiksaiah
    ciskgkklvlnhlfmitdtlvisdglhvecltsdsgvksdvpagkfavkitgansgwfgg
    kilgknlpesttvrqdgvlfdenaeycfitgtevtgffakglhtsdadgvgygiydkgyg
    tliskcyanskfcvalggtegrvlknritnnyltsgeakpwswasnywdgivsenahryv
    iafndvsacgqsgiyfggnggystdniivnntvyacwnrgidmglfseksatndvlrnii
    kgnntynnrenniwlagvsncsvvgntswfdtnydvifagypgghicislasgangeacv
    gntidsntcidprgnagitvptgatgnvfgsgnnlsqagaiyiaspdlitsnrfelavtg
    sftpvllpesgsitlsssstgvfratgnridfsvtvnvssisspsgnlniaylpgmsgkt
    sstsmfiidywndltlssgviplaslnlenqdqitvyrtdggrvlydfsslmkstssfil
    kgfvdfn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6f7kC (C:)
    mlrgelnnegvinfshadtygndsvgahlqnvvyptdapfnaatdgttdttvaiksaiah
    ciskgkklvlnhlfmitdtlvisdglhvecltsdsgvksdvpagkfavkitgansgwfgg
    kilgknlpesttvrqdgvlfdenaeycfitgtevtgffakglhtsdadgvgygiydkgyg
    tliskcyanskfcvalggtegrvlknritnnyltsgeakpwswasnywdgivsenahryv
    iafndvsacgqsgiyfggnggystdniivnntvyacwnrgidmglfseksatndvlrnii
    kgnntynnrenniwlagvsncsvvgntswfdtnydvifagypgghicislasgangeacv
    gntidsntcidprgnagitvptgatgnvfgsgnnlsqagaiyiaspdlitsnrfelavtg
    sftpvllpesgsitlsssstgvfratgnridfsvtvnvssisspsgnlniaylpgmsgkt
    sstsmfiidywndltlssgviplaslnlenqdqitvyrtdggrvlydfsslmkstssfil
    kgfvdfn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >6f7kD (D:)
    mlrgelnnegvinfshadtygndsvgahlqnvvyptdapfnaatdgttdttvaiksaiah
    ciskgkklvlnhlfmitdtlvisdglhvecltsdsgvksdvpagkfavkitgansgwfgg
    kilgknlpesttvrqdgvlfdenaeycfitgtevtgffakglhtsdadgvgygiydkgyg
    tliskcyanskfcvalggtegrvlknritnnyltsgeakpwswasnywdgivsenahryv
    iafndvsacgqsgiyfggnggystdniivnntvyacwnrgidmglfseksatndvlrnii
    kgnntynnrenniwlagvsncsvvgntswfdtnydvifagypgghicislasgangeacv
    gntidsntcidprgnagitvptgatgnvfgsgnnlsqagaiyiaspdlitsnrfelavtg
    sftpvllpesgsitlsssstgvfratgnridfsvtvnvssisspsgnlniaylpgmsgkt
    sstsmfiidywndltlssgviplaslnlenqdqitvyrtdggrvlydfsslmkstssfil
    kgfvdfn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >6f7kF (F:)
    mlrgelnnegvinfshadtygndsvgahlqnvvyptdapfnaatdgttdttvaiksaiah
    ciskgkklvlnhlfmitdtlvisdglhvecltsdsgvksdvpagkfavkitgansgwfgg
    kilgknlpesttvrqdgvlfdenaeycfitgtevtgffakglhtsdadgvgygiydkgyg
    tliskcyanskfcvalggtegrvlknritnnyltsgeakpwswasnywdgivsenahryv
    iafndvsacgqsgiyfggnggystdniivnntvyacwnrgidmglfseksatndvlrnii
    kgnntynnrenniwlagvsncsvvgntswfdtnydvifagypgghicislasgangeacv
    gntidsntcidprgnagitvptgatgnvfgsgnnlsqagaiyiaspdlitsnrfelavtg
    sftpvllpesgsitlsssstgvfratgnridfsvtvnvssisspsgnlniaylpgmsgkt
    sstsmfiidywndltlssgviplaslnlenqdqitvyrtdggrvlydfsslmkstssfil
    kgfvdfn
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >6f7kG (G:)
    mlrgelnnegvinfshadtygndsvgahlqnvvyptdapfnaatdgttdttvaiksaiah
    ciskgkklvlnhlfmitdtlvisdglhvecltsdsgvksdvpagkfavkitgansgwfgg
    kilgknlpesttvrqdgvlfdenaeycfitgtevtgffakglhtsdadgvgygiydkgyg
    tliskcyanskfcvalggtegrvlknritnnyltsgeakpwswasnywdgivsenahryv
    iafndvsacgqsgiyfggnggystdniivnntvyacwnrgidmglfseksatndvlrnii
    kgnntynnrenniwlagvsncsvvgntswfdtnydvifagypgghicislasgangeacv
    gntidsntcidprgnagitvptgatgnvfgsgnnlsqagaiyiaspdlitsnrfelavtg
    sftpvllpesgsitlsssstgvfratgnridfsvtvnvssisspsgnlniaylpgmsgkt
    sstsmfiidywndltlssgviplaslnlenqdqitvyrtdggrvlydfsslmkstssfil
    kgfvdfn