PDB entry 6f7d

View 6f7d on RCSB PDB site
Description: crystal structure of dettilon tailspike protein (gp208)
Deposited on 2017-12-08, released 2018-12-19
The last revision was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tailspike
    Species: Salmonella phage Det7 [TaxId:454798]
    Gene: 208, DET7_208
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6f7dA (A:)
    gvinfshadtygndsvgahlqnvvyptdapfnaatdgttdttvaiksaiahciskgkklv
    lnhlfmitdtlvisdglhvecltsdsgvksdvpagkfavkitgansgwfggkilgknlpe
    sttvrqdgvlfdenaeycfitgtevtgffakglhtsdadgvgygiydkgygtliskcyan
    skfcvalggtegrvlknritnnyltsgeakpwswasnywdgivsenahryviafndvsac
    gqsgiyfggnggystdniivnntvyacwnrgidmglfseksatndvlrniikgnntynnr
    enniwlagvsncsvvgntswfdtnydvifagypgghicislasgangeacvgntidsntc
    idprgnagitvptgatgnvfgsgnnlsqagaiyiaspdlitsnrfelavtgsftpvllpe
    sgsitlsssstgvfratgnridfsvtvnvssisspsgnlniaylpgmsgktsstsmfiid
    ywndltlssgviplaslnlenqdqitvyrtdggrvlydfsslmkstssfilkgfvdfn