PDB entry 6f77

View 6f77 on RCSB PDB site
Description: Crystal structure of the prephenate aminotransferase from Rhizobium meliloti
Class: transferase
Keywords: Prephenate aminotransferase Rhizobium meliloti, TRANSFERASE
Deposited on 2017-12-07, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartate aminotransferase A
    Species: Rhizobium meliloti (strain 1021) [TaxId:266834]
    Gene: aatA, R02325, SMc01578
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f77a_
  • Chain 'B':
    Compound: Aspartate aminotransferase A
    Species: Rhizobium meliloti (strain 1021) [TaxId:266834]
    Gene: aatA, R02325, SMc01578
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f77b_
  • Chain 'C':
    Compound: Aspartate aminotransferase A
    Species: Rhizobium meliloti (strain 1021) [TaxId:266834]
    Gene: aatA, R02325, SMc01578
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f77c_
  • Chain 'D':
    Compound: Aspartate aminotransferase A
    Species: Rhizobium meliloti (strain 1021) [TaxId:266834]
    Gene: aatA, R02325, SMc01578
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f77d_
  • Chain 'E':
    Compound: Aspartate aminotransferase A
    Species: Rhizobium meliloti (strain 1021) [TaxId:266834]
    Gene: aatA, R02325, SMc01578
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f77e_
  • Chain 'F':
    Compound: Aspartate aminotransferase A
    Species: Rhizobium meliloti (strain 1021) [TaxId:266834]
    Gene: aatA, R02325, SMc01578
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f77f_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f77A (A:)
    mafladalsrvkpsatiavsqkarelkakgrdviglgagepdfdtpdnikkaaidaidrg
    etkytpvsgipelreaiakkfkrennldytaaqtivgtggkqilfnafmatlnpgdevvi
    papywvsypemvalcggtpvfvptrqennfklkaedldraitpktkwfvfnspsnpsgaa
    ysheelkaltdvlmkhphvwvltddmyehltygdfrfatpvevepglyertltmngvska
    yamtgwrigyaagplhlikamdmiqgqqtsgaasiaqwaavealngpqdfigrnkeifqg
    rrdlvvsmlnqakgiscptpegafyvypscagligktapsgkvietdedfvselletegv
    avvhgsafglgpnfrisyatsealleeacrriqrfcaacr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f77A (A:)
    afladalsrvkpsatiavsqkarelkakgrdviglgagepdfdtpdnikkaaidaidrge
    tkytpvsgipelreaiakkfkrennldytaaqtivgtggkqilfnafmatlnpgdevvip
    apywvsypemvalcggtpvfvptrqennfklkaedldraitpktkwfvfnspsnpsgaay
    sheelkaltdvlmkhphvwvltddmyehltygdfrfatpvevepglyertltmngvskay
    amtgwrigyaagplhlikamdmiqgqqtsgaasiaqwaavealngpqdfigrnkeifqgr
    rdlvvsmlnqakgiscptpegafyvypscagligktapsgkvietdedfvselletegva
    vvhgsafglgpnfrisyatsealleeacrriqrfcaacr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6f77B (B:)
    mafladalsrvkpsatiavsqkarelkakgrdviglgagepdfdtpdnikkaaidaidrg
    etkytpvsgipelreaiakkfkrennldytaaqtivgtggkqilfnafmatlnpgdevvi
    papywvsypemvalcggtpvfvptrqennfklkaedldraitpktkwfvfnspsnpsgaa
    ysheelkaltdvlmkhphvwvltddmyehltygdfrfatpvevepglyertltmngvska
    yamtgwrigyaagplhlikamdmiqgqqtsgaasiaqwaavealngpqdfigrnkeifqg
    rrdlvvsmlnqakgiscptpegafyvypscagligktapsgkvietdedfvselletegv
    avvhgsafglgpnfrisyatsealleeacrriqrfcaacr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f77B (B:)
    afladalsrvkpsatiavsqkarelkakgrdviglgagepdfdtpdnikkaaidaidrge
    tkytpvsgipelreaiakkfkrennldytaaqtivgtggkqilfnafmatlnpgdevvip
    apywvsypemvalcggtpvfvptrqennfklkaedldraitpktkwfvfnspsnpsgaay
    sheelkaltdvlmkhphvwvltddmyehltygdfrfatpvevepglyertltmngvskay
    amtgwrigyaagplhlikamdmiqgqqtsgaasiaqwaavealngpqdfigrnkeifqgr
    rdlvvsmlnqakgiscptpegafyvypscagligktapsgkvietdedfvselletegva
    vvhgsafglgpnfrisyatsealleeacrriqrfcaacr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6f77C (C:)
    mafladalsrvkpsatiavsqkarelkakgrdviglgagepdfdtpdnikkaaidaidrg
    etkytpvsgipelreaiakkfkrennldytaaqtivgtggkqilfnafmatlnpgdevvi
    papywvsypemvalcggtpvfvptrqennfklkaedldraitpktkwfvfnspsnpsgaa
    ysheelkaltdvlmkhphvwvltddmyehltygdfrfatpvevepglyertltmngvska
    yamtgwrigyaagplhlikamdmiqgqqtsgaasiaqwaavealngpqdfigrnkeifqg
    rrdlvvsmlnqakgiscptpegafyvypscagligktapsgkvietdedfvselletegv
    avvhgsafglgpnfrisyatsealleeacrriqrfcaacr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f77C (C:)
    afladalsrvkpviglgagepdfdtpdnikkaaidaidrgetkytpvsgipelreaiakk
    fkrennldytaaqtivgtggkqilfnafmatlnpgdevvipapywvsypemvalcggtpv
    fvptrqennfklkaedldraitpktkwfvfnspsnpsgaaysheelkaltdvlmkhphvw
    vltddmyehltygdfrfatpvevepglyertltmngvskayamtgwrigyaagplhlika
    mdmiqgqqtsgaasiaqwaavealngpqdfigrnkeifqgrrdlvvsmlnqakgiscptp
    egafyvypscagligktapsgkvietdedfvselletegvavvhgsafglgpnfrisyat
    sealleeacrriqrfcaacr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6f77D (D:)
    mafladalsrvkpsatiavsqkarelkakgrdviglgagepdfdtpdnikkaaidaidrg
    etkytpvsgipelreaiakkfkrennldytaaqtivgtggkqilfnafmatlnpgdevvi
    papywvsypemvalcggtpvfvptrqennfklkaedldraitpktkwfvfnspsnpsgaa
    ysheelkaltdvlmkhphvwvltddmyehltygdfrfatpvevepglyertltmngvska
    yamtgwrigyaagplhlikamdmiqgqqtsgaasiaqwaavealngpqdfigrnkeifqg
    rrdlvvsmlnqakgiscptpegafyvypscagligktapsgkvietdedfvselletegv
    avvhgsafglgpnfrisyatsealleeacrriqrfcaacr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f77D (D:)
    afladalsrvkpsatiavsqkarelkakgrdviglgagepdfdtpdnikkaaidaidrge
    tkytpvsgipelreaiakkfkrennldytaaqtivgtggkqilfnafmatlnpgdevvip
    apywvsypemvalcggtpvfvptrqennfklkaedldraitpktkwfvfnspsnpsgaay
    sheelkaltdvlmkhphvwvltddmyehltygdfrfatpvevepglyertltmngvskay
    amtgwrigyaagplhlikamdmiqgqqtsgaasiaqwaavealngpqdfigrnkeifqgr
    rdlvvsmlnqakgiscptpegafyvypscagligktapsgkvietdedfvselletegva
    vvhgsafglgpnfrisyatsealleeacrriqrfcaacr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6f77E (E:)
    mafladalsrvkpsatiavsqkarelkakgrdviglgagepdfdtpdnikkaaidaidrg
    etkytpvsgipelreaiakkfkrennldytaaqtivgtggkqilfnafmatlnpgdevvi
    papywvsypemvalcggtpvfvptrqennfklkaedldraitpktkwfvfnspsnpsgaa
    ysheelkaltdvlmkhphvwvltddmyehltygdfrfatpvevepglyertltmngvska
    yamtgwrigyaagplhlikamdmiqgqqtsgaasiaqwaavealngpqdfigrnkeifqg
    rrdlvvsmlnqakgiscptpegafyvypscagligktapsgkvietdedfvselletegv
    avvhgsafglgpnfrisyatsealleeacrriqrfcaacr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f77E (E:)
    afladalsrvkpsatiavsqkarelkakgrdviglgagepdfdtpdnikkaaidaidrge
    tkytpvsgipelreaiakkfkrennldytaaqtivgtggkqilfnafmatlnpgdevvip
    apywvsypemvalcggtpvfvptrqennfklkaedldraitpktkwfvfnspsnpsgaay
    sheelkaltdvlmkhphvwvltddmyehltygdfrfatpvevepglyertltmngvskay
    amtgwrigyaagplhlikamdmiqgqqtsgaasiaqwaavealngpqdfigrnkeifqgr
    rdlvvsmlnqakgiscptpegafyvypscagligktapsgkvietdedfvselletegva
    vvhgsafglgpnfrisyatsealleeacrriqrfcaacr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6f77F (F:)
    mafladalsrvkpsatiavsqkarelkakgrdviglgagepdfdtpdnikkaaidaidrg
    etkytpvsgipelreaiakkfkrennldytaaqtivgtggkqilfnafmatlnpgdevvi
    papywvsypemvalcggtpvfvptrqennfklkaedldraitpktkwfvfnspsnpsgaa
    ysheelkaltdvlmkhphvwvltddmyehltygdfrfatpvevepglyertltmngvska
    yamtgwrigyaagplhlikamdmiqgqqtsgaasiaqwaavealngpqdfigrnkeifqg
    rrdlvvsmlnqakgiscptpegafyvypscagligktapsgkvietdedfvselletegv
    avvhgsafglgpnfrisyatsealleeacrriqrfcaacr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f77F (F:)
    afladalsrvkpsatiavsqkarelkakgrdviglgagepdfdtpdnikkaaidaidrge
    tkytpvsgipelreaiakkfkrennldytaaqtivgtggkqilfnafmatlnpgdevvip
    apywvsypemvalcggtpvfvptrqennfklkaedldraitpktkwfvfnspsnpsgaay
    sheelkaltdvlmkhphvwvltddmyehltygdfrfatpvevepglyertltmngvskay
    amtgwrigyaagplhlikamdmiqgqqtsgaasiaqwaavealngpqdfigrnkeifqgr
    rdlvvsmlnqakgiscptpegafyvypscagligktapsgkvietdedfvselletegva
    vvhgsafglgpnfrisyatsealleeacrriqrfcaacr