PDB entry 6f6z

View 6f6z on RCSB PDB site
Description: Mouse Thymidylate Synthase Cocrystallized with N(4)OHdCMP and Soaked in Methylenetetrahydrofolate
Class: transferase
Keywords: enzyme, inhibitor, cofactor, TRANSFERASE
Deposited on 2017-12-06, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidylate synthase
    Species: Mus musculus [TaxId:10090]
    Gene: Tyms
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f6za_
  • Chain 'B':
    Compound: Thymidylate synthase
    Species: Mus musculus [TaxId:10090]
    Gene: Tyms
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f6zb_
  • Heterogens: NOH, TGQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f6zA (A:)
    mlvvgselqsdaqqlsaeaprhgelqylrqvehilrcgfkkedrtgtgtlsvfgmqarys
    lrdefpllttkrvfwkgvleellwfikgstnakelsskgvriwdangsrdfldslgfsar
    qegdlgpvygfqwrhfgaeykdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkd
    lplmalppchalcqfyvvngelscqlyqrsgdmglgvpfniasyalltymiahitglqpg
    dfvhtlgdahiylnhieplkiqlqreprpfpklkilrkvetiddfkvedfqiegynphpt
    ikmemav
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f6zA (A:)
    rhgelqylrqvehilrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvle
    ellwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgaey
    kdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvng
    elscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplk
    iqlqreprpfpklkilrkvetiddfkvedfqiegynphptikmemav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6f6zB (B:)
    mlvvgselqsdaqqlsaeaprhgelqylrqvehilrcgfkkedrtgtgtlsvfgmqarys
    lrdefpllttkrvfwkgvleellwfikgstnakelsskgvriwdangsrdfldslgfsar
    qegdlgpvygfqwrhfgaeykdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkd
    lplmalppchalcqfyvvngelscqlyqrsgdmglgvpfniasyalltymiahitglqpg
    dfvhtlgdahiylnhieplkiqlqreprpfpklkilrkvetiddfkvedfqiegynphpt
    ikmemav
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f6zB (B:)
    rhgelqylrqvehilrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvle
    ellwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgaey
    kdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvng
    elscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplk
    iqlqreprpfpklkilrkvetiddfkvedfqiegynphptikmemav