PDB entry 6f6y

View 6f6y on RCSB PDB site
Description: Crystal structure of galectin-3 CRD in complex with galactopentaose
Class: sugar binding protein
Keywords: galectin, carbohydrate recognition, SUGAR BINDING PROTEIN
Deposited on 2017-12-06, released 2018-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Galectin-3
  Species: Homo sapiens [TaxId:9606]
  Gene: LGALS3, MAC2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17931 (1-137)
    • initiating methionine (0)
  Domains in SCOPe 2.08: d6f6ya1, d6f6ya2
• Heterogens: GAL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6f6yA (A:)
  mlivpynlplpggvvprmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrviv
  cntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneis
  klgisgdidltsasytmi