PDB entry 6f6r

View 6f6r on RCSB PDB site
Description: crystal structure of human caspase-1 with n-{3-[1-((s)-2-hydroxy-5- oxo-tetrahydro-furan-3-ylcarbamoyl)-ethyl]-1-methyl-2,4-dioxo-1,2,3, 4-tetrahydro-pyrimidin-5-yl}-4-(quinoxalin-2-ylamino)-benzamide
Deposited on 2017-12-06, released 2018-05-02
The last revision was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caspase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP1, IL1BC, IL1BCE
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Caspase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP1, IL1BC, IL1BCE
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CVE, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6f6rA (A:)
qdnpamptssgsegnvklcsleeaqriwkqksaeiypimdkssrtrlaliicneefdsip
rrtgaevditgmtmllqnlgysvdvkknltasdmtteleafahrpehktsdstflvfmsh
giregicgkkhseqvpdilqlnaifnmlntkncpslkdkpkviiiqacrgdspgvvwfkd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6f6rB (B:)
aikkahiekdfiafcsstpdnvswrhptmgsvfigrliehmqeyacscdveeifrkvrfs
feqpdgraqmpttervtltrcfylfpgh