PDB entry 6f6m

View 6f6m on RCSB PDB site
Description: r2-like ligand-binding oxidase y162f mutant with anaerobically reconstituted mn/fe cofactor
Deposited on 2017-12-05, released 2018-12-19
The last revision was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonucleotide reductase small subunit
    Species: Geobacillus kaustophilus (strain HTA426) [TaxId:235909]
    Gene: GK2771
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5KW80
      • engineered mutation (175)
  • Chain 'B':
    Compound: Ribonucleotide reductase small subunit
    Species: Geobacillus kaustophilus (strain HTA426) [TaxId:235909]
    Gene: GK2771
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5KW80
      • engineered mutation (175)
  • Heterogens: FE2, MN, PLM, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6f6mA (A:)
    mahhhhhhvddddkmvhhdgfqtvkatidwehpmfklyekakrngkwnpadidfsqdqkd
    fasltseekisalplvagfsageeavtldilpmahalarqgrledvlflttfmhdeakhv
    emfsrwqqavgigqmdlsvfhndhykrifyealpeamnrlyaddspeaviraatvfnmiv
    egtlaesgyytfrqiykkaglfpgllqgidylnmdegrhiqfgiytiqrivnederyyel
    firymdelwphvigyvdyltelgkrqqqlartyaleidydllrhyvikqfnlrkkqisrt
    krvdvveglektaaes
    

    Sequence, based on observed residues (ATOM records):
    >6f6mA (A:)
    hhdgfqtvkatidwehpmfklyekakrngkwnpadidfsqdqkdfasltseekisalplv
    agfsageeavtldilpmahalarqgrledvlflttfmhdeakhvemfsrwqqavgigqmd
    lsvfhndhykrifyealpeamnrlyaddspeaviraatvfnmivegtlaesgyytfrqiy
    kkaglfpgllqgidylnmdegrhiqfgiytiqrivnederyyelfirymdelwphvigyv
    dyltelgkidydllrhyvikqfnlrkkqisrt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6f6mB (B:)
    mahhhhhhvddddkmvhhdgfqtvkatidwehpmfklyekakrngkwnpadidfsqdqkd
    fasltseekisalplvagfsageeavtldilpmahalarqgrledvlflttfmhdeakhv
    emfsrwqqavgigqmdlsvfhndhykrifyealpeamnrlyaddspeaviraatvfnmiv
    egtlaesgyytfrqiykkaglfpgllqgidylnmdegrhiqfgiytiqrivnederyyel
    firymdelwphvigyvdyltelgkrqqqlartyaleidydllrhyvikqfnlrkkqisrt
    krvdvveglektaaes
    

    Sequence, based on observed residues (ATOM records):
    >6f6mB (B:)
    hhdgfqtvkatidwehpmfklyekakrngkwnpadidfsqdqkdfasltseekisalplv
    agfsageeavtldilpmahalarqgrledvlflttfmhdeakhvemfsrwqqavgigqmd
    lsvfhndhykrifyealpeamnrlyaddspeaviraatvfnmivegtlaesgyytfrqiy
    kkaglfpgllqgidylnmdegrhiqfgiytiqrivnederyyelfirymdelwphvigyv
    dyltelgkrqqqlartyaleidydllrhyvikqfnlrkkqisrt