PDB entry 6f6i

View 6f6i on RCSB PDB site
Description: crystal structure of ebolavirus glycoprotein in complex with paroxetine
Deposited on 2017-12-05, released 2018-01-03
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope glycoprotein,GP,GP1
    Species: Ebola virus [TaxId:1570291]
    Gene: GP, DH33_45402gpGP
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3NBB1 (4-End)
      • expression tag (3)
      • engineered mutation (14)
    • Uniprot A0A0D5W976
    • PDB 6F6I (323-329)
  • Chain 'B':
    Compound: Envelope glycoprotein
    Species: Ebola virus [TaxId:1570291]
    Gene: GP, DF49_53415gpGP, DF49_53416gpGP, DF49_53417gpGP, DF49_53418gpGP, DF49_53419gpGP, DF49_53420gpGP, DF49_53421gpGP, DF49_53422gpGP, DF49_53423gpGP, DF49_53424gpGP, DF49_53425gpGP, DF49_53426gpGP
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0U3BWW0 (0-130)
      • engineered mutation (111)
  • Heterogens: NAG, DMS, GOL, 8PR, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6f6iA (A:)
    etgrsiplgvihnsalqvsdvdklvcrdklsstnqlrsvglnlegngvatdvpsatkrwg
    frsgvppkvvnyeagewaencynleikkpdgseclpaapdgirgfprcryvhkvsgtgpc
    agdfafhkegafflydrlastviyrgttfaegvvaflilpqakkdffsshplrepvnate
    dpssgyysttiryqatgfgtneteylfevdnltyvqlesrftpqfllqlnetiytsgkrs
    nttgkliwkvnpeidttigewafwetkknltrkirseelsftvvsthhqdtgeesassgk
    lglitntiagvaglitggrrtrrxxxxxxx
    

    Sequence, based on observed residues (ATOM records):
    >6f6iA (A:)
    rsiplgvihnsalqvsdvdklvcrdklsstnqlrsvglnlegngvatdvpsatkrwgfrs
    gvppkvvnyeagewaencynleikkpdgseclpaapdgirgfprcryvhkvsgtgpcagd
    fafhkegafflydrlastviyrgttfaegvvaflilpqasgyysttiryqatgfgtnete
    ylfevdnltyvqlesrftpqfllqlnetiytsgkrsnttgkliwkvnpeidtwafwetls
    ftvvxxxxxxx
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6f6iB (B:)
    eaivnaqpkcnpnlhywttqdegaaiglawipyfgpaaegiyieglmhnqdglicglrql
    anettqalqlflrattelrtfsilnrkaidfllqrwggtchilgpdcciepadwtknitd
    kidqiihdfvdgsgyipeaprdgqayvrkdgewvllstflgthhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6f6iB (B:)
    eaivnaqpkcnpnlhywttqdegaaiglawipyfgpaaegiyieglmhnqdglicglrql
    anettqalqlflrattelrtfsilnrkaidfllqrwggtchilgpdcciepadwtknitd
    kidqiihdfvd