PDB entry 6f5x

View 6f5x on RCSB PDB site
Description: crystal structure of the sycp1 n-terminal head-to-head assembly in closed conformation
Deposited on 2017-12-04, released 2018-06-06
The last revision was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptonemal complex protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SYCP1, SCP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15431 (3-End)
      • expression tag (0-2)
  • Heterogens: IOD, PGE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6f5xA (A:)
gsmglsrvysklykeaekikkwkvsteaelrqkesklqenrkiieaqrkaiqelqfgnek
vslkleegiqenkdlike

    Sequence, based on observed residues (ATOM records):
    >6f5xA (A:)
gsmglsrvysklykeaekikkwkvsteaelrqkesklqenrkiieaqrkaiqelqfgnek
vslkleegiqenkdli