PDB entry 6f5v

View 6f5v on RCSB PDB site
Description: Crystal structure of the prephenate aminotransferase from Arabidopsis thaliana
Class: transferase
Keywords: Prephenate aminotransferase Arabidopsis thaliana, TRANSFERASE
Deposited on 2017-12-03, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PAT, AAT, MEE17, At2g22250, T26C19.9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f5va_
  • Chain 'B':
    Compound: Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PAT, AAT, MEE17, At2g22250, T26C19.9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f5vb_
  • Chain 'C':
    Compound: Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PAT, AAT, MEE17, At2g22250, T26C19.9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f5vc_
  • Chain 'D':
    Compound: Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PAT, AAT, MEE17, At2g22250, T26C19.9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f5vd_
  • Heterogens: PLP, NA, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f5vA (A:)
    masqssvavissaaargesfpdskkpigsvrfqqplrlsfsycksgnmssricamakpnd
    aetlsssvdmslsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaea
    ginairegftrytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavc
    spgdeviipapywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcs
    psnptgsvypkslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertlt
    vngfskafamtgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkagget
    vaemvkayrerrdflvkslgdikgvkisepqgafylfidfsayygseaegfglindsssl
    alyfldkfqvamvpgdafgddscirisyatsldvlqaavekirkaleplratvsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f5vA (A:)
    slsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaeaginairegft
    rytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavcspgdeviipa
    pywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcspsnptgsvyp
    kslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertltvngfskafam
    tgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkaggetvaemvkayre
    rrdflvkslgdikgvkisepqgafylfidfsayygseaegfglindssslalyfldkfqv
    amvpgdafgddscirisyatsldvlqaavekirkaleplra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6f5vB (B:)
    masqssvavissaaargesfpdskkpigsvrfqqplrlsfsycksgnmssricamakpnd
    aetlsssvdmslsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaea
    ginairegftrytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavc
    spgdeviipapywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcs
    psnptgsvypkslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertlt
    vngfskafamtgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkagget
    vaemvkayrerrdflvkslgdikgvkisepqgafylfidfsayygseaegfglindsssl
    alyfldkfqvamvpgdafgddscirisyatsldvlqaavekirkaleplratvsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f5vB (B:)
    vdmslsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaeaginaire
    gftrytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavcspgdevi
    ipapywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcspsnptgs
    vypkslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertltvngfska
    famtgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkaggetvaemvka
    yrerrdflvkslgdikgvkisepqgafylfidfsayygseaegfglindssslalyfldk
    fqvamvpgdafgddscirisyatsldvlqaavekirkaleplr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6f5vC (C:)
    masqssvavissaaargesfpdskkpigsvrfqqplrlsfsycksgnmssricamakpnd
    aetlsssvdmslsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaea
    ginairegftrytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavc
    spgdeviipapywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcs
    psnptgsvypkslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertlt
    vngfskafamtgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkagget
    vaemvkayrerrdflvkslgdikgvkisepqgafylfidfsayygseaegfglindsssl
    alyfldkfqvamvpgdafgddscirisyatsldvlqaavekirkaleplratvsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f5vC (C:)
    slsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaeaginairegft
    rytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavcspgdeviipa
    pywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcspsnptgsvyp
    kslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertltvngfskafam
    tgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkaggetvaemvkayre
    rrdflvkslgdikgvkisepqgafylfidfsayygseaegfglindssslalyfldkfqv
    amvpgdafgddscirisyatsldvlqaavekirkalepl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6f5vD (D:)
    masqssvavissaaargesfpdskkpigsvrfqqplrlsfsycksgnmssricamakpnd
    aetlsssvdmslsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaea
    ginairegftrytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavc
    spgdeviipapywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcs
    psnptgsvypkslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertlt
    vngfskafamtgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkagget
    vaemvkayrerrdflvkslgdikgvkisepqgafylfidfsayygseaegfglindsssl
    alyfldkfqvamvpgdafgddscirisyatsldvlqaavekirkaleplratvsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f5vD (D:)
    svdmslsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaeaginair
    egftrytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavcspgdev
    iipapywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcspsnptg
    svypkslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertltvngfsk
    afamtgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkaggetvaemvk
    ayrerrdflvkslgdikgvkisepqgafylfidfsayygseaegfglindssslalyfld
    kfqvamvpgdafgddscirisyatsldvlqaavekirkalepl