PDB entry 6f5u

View 6f5u on RCSB PDB site
Description: crystal structure of ebolavirus glycoprotein in complex with bepridil
Deposited on 2017-12-03, released 2018-01-03
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope glycoprotein,Envelope glycoprotein,GP1
    Species: Ebola virus [TaxId:1570291]
    Gene: GP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05320 (4-End)
      • engineered mutation (14)
    • PDB 6F5U (285-End)
  • Chain 'B':
    Compound: Envelope glycoprotein
    Species: Zaire ebolavirus (strain Mayinga-76) [TaxId:128952]
    Gene: GP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05320 (0-130)
      • engineered mutation (111)
  • Heterogens: CQN, NAG, GOL, DMS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6f5uA (A:)
    etgrsiplgvihnsalqvsdvdklvcrdklsstnqlrsvglnlegngvatdvpsatkrwg
    frsgvppkvvnyeagewaencynleikkpdgseclpaapdgirgfprcryvhkvsgtgpc
    agdfafhkegafflydrlastviyrgttfaegvvaflilpqakkdffsshplrepvnate
    dpssgyysttiryqatgfgtneteylfevdnltyvqlesrftpqfllqlnetiytsgkrs
    nttgkliwkvnpeidttigewafwetkknltrkirseelsftvvsxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

    Sequence, based on observed residues (ATOM records):
    >6f5uA (A:)
    siplgvihnsalqvsdvdklvcrdklsstnqlrsvglnlegngvatdvpsatkrwgfrsg
    vppkvvnyeagewaencynleikkpdgseclpaapdgirgfprcryvhkvsgtgpcagdf
    afhkegafflydrlastviyrgttfaegvvaflilpqasgyysttiryqatgfgtnetey
    lfevdnltyvqlesrftpqfllqlnetiytsgkrsnttgkliwkvnpeidttwafwelsf
    tvvxxxxxxx
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6f5uB (B:)
    eaivnaqpkcnpnlhywttqdegaaiglawipyfgpaaegiyieglmhnqdglicglrql
    anettqalqlflrattelrtfsilnrkaidfllqrwggtchilgpdcciepadwtknitd
    kidqiihdfvdgsgyipeaprdgqayvrkdgewvllstflgthhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6f5uB (B:)
    eaivnaqpkcnpnlhywttqdegaaiglawipyfgpaaegiyieglmhnqdglicglrql
    anettqalqlflrattelrtfsilnrkaidfllqrwggtchilgpdcciepadwtknitd
    kidqiihdfvd