PDB entry 6f5t

View 6f5t on RCSB PDB site
Description: Crystal Structure of KDM4D with tetrazole ligand GF057
Class: oxidoreductase
Keywords: KDM4D, ligand binding, ligand optimization, drug development, tetrazole, inhibitor design, cancer, epigenetics, OXIDOREDUCTASE
Deposited on 2017-12-02, released 2018-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine-specific demethylase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM4D, JHDM3D, JMJD2D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6f5ta_
  • Heterogens: ZN, SO4, NI, CQK, EPE, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f5tA (A:)
    aqnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkaretydniseil
    iatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphqnfedlerkywknri
    ynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpylyfgmwkttfa
    whtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcgaflrhkvalis
    ptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprwidygkmasqc
    scgearvtfsmdafvrilqperydlwkrgq