PDB entry 6f5n

View 6f5n on RCSB PDB site
Description: nickel-bound crystal structure of a gb1 variant
Deposited on 2017-12-01, released 2018-12-12
The last revision was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nickel-Binding Protein
    Species: Streptococcus [TaxId:1301]
    Database cross-references and differences (RAF-indexed):
    • PDB 6F5N (0-55)
  • Chain 'B':
    Compound: Nickel-Binding Protein
    Species: Streptococcus [TaxId:1301]
    Database cross-references and differences (RAF-indexed):
    • PDB 6F5N (0-55)
  • Heterogens: NI, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6f5nA (A:)
mqfklilngktlkgvitieavdhaeaekffkqyandngvdgewtydeathtftvte

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6f5nB (B:)
mqfklilngktlkgvitieavdhaeaekffkqyandngvdgewtydeathtftvte