PDB entry 6f5h

View 6f5h on RCSB PDB site
Description: Crystal structure of USP7 in complex with a 4-hydroxypiperidine based inhibitor
Class: hydrolase
Keywords: USP7, reversible, inhibitor, selective, hydrolase
Deposited on 2017-12-01, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 7
    Species: Homo sapiens [TaxId:9606]
    Gene: USP7, HAUSP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93009 (0-353)
      • expression tag (354-356)
    Domains in SCOPe 2.07: d6f5ha1, d6f5ha2
  • Chain 'B':
    Compound: Ubiquitin carboxyl-terminal hydrolase 7
    Species: Homo sapiens [TaxId:9606]
    Gene: USP7, HAUSP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f5hb_
  • Heterogens: CQ5, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f5hA (A:)
    skkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfye
    lqhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrg
    kmvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehgl
    qeaekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpa
    nyilhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdddls
    vrhctnaymlvyiresklsevlqavtdhdipqqlverlqeekrieaqkrkerqehhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f5hA (A:)
    skkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfye
    lqhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrg
    kmvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehgl
    qeaekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpa
    nyilhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnyggrhctna
    ymlvyiresklsevlqavtdhdipqqlverlqeekrieaqkrkerqehhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6f5hB (B:)
    skkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfye
    lqhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrg
    kmvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehgl
    qeaekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpa
    nyilhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdddls
    vrhctnaymlvyiresklsevlqavtdhdipqqlverlqeekrieaqkrkerqehhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f5hB (B:)
    kkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyel
    qhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrgk
    mvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglq
    eaekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpan
    yilhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghhctnay
    mlvyiresklsevlqavtdhdipqqlverlqeekrie