PDB entry 6f5g

View 6f5g on RCSB PDB site
Description: Complete PCSK9 C-ter domain in complex with VHH P.140
Class: hydrolase
Keywords: Complex, PCSK9, VHH, HYDROLASE
Deposited on 2017-12-01, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proprotein convertase subtilisin/kexin type 9
    Species: Homo sapiens [TaxId:9606]
    Gene: PCSK9, NARC1, PSEC0052
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: VHH minibody anti-Cter PCSK9
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6F5G (Start-127)
    Domains in SCOPe 2.07: d6f5gb_
  • Heterogens: NAG, BMA, MAN, FUC, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6f5gB (B:)
    gqvkleesggglvqaggslrlscspsdrtfsayamgwfrqvpgrerefvatirdsdasiy
    ytdsvkgrftisrdnakntvylqmnslipddtavyycaarqyysgrvystfreeydywgq
    gtqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f5gB (B:)
    qvkleesggglvqaggslrlscspsdrtfsayamgwfrqvpgrerefvatirdsdasiyy
    tdsvkgrftisrdnakntvylqmnslipddtavyycaarqyysgrvystfreeydywgqg
    tqvtvss