PDB entry 6f56

View 6f56 on RCSB PDB site
Description: Mutant of Human N-myristoyltransferase with bound myristoyl-CoA
Class: transferase
Keywords: N-Myristoyltransferase, mutant, parasite, TRANSFERASE
Deposited on 2017-11-30, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycylpeptide N-tetradecanoyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NMT1, NMT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30419 (Start-409)
      • engineered mutation (208)
      • engineered mutation (210)
      • engineered mutation (365-366)
      • engineered mutation (375)
      • engineered mutation (386)
      • engineered mutation (408-409)
    Domains in SCOPe 2.07: d6f56a1
  • Chain 'B':
    Compound: Glycylpeptide N-tetradecanoyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NMT1, NMT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30419 (Start-409)
      • engineered mutation (208)
      • engineered mutation (210)
      • engineered mutation (365-366)
      • engineered mutation (375)
      • engineered mutation (386)
      • engineered mutation (408-409)
    Domains in SCOPe 2.07: d6f56b1
  • Chain 'C':
    Compound: Glycylpeptide N-tetradecanoyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NMT1, NMT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30419 (Start-409)
      • engineered mutation (208)
      • engineered mutation (210)
      • engineered mutation (365-366)
      • engineered mutation (375)
      • engineered mutation (386)
      • engineered mutation (408-409)
    Domains in SCOPe 2.07: d6f56c1
  • Chain 'D':
    Compound: Glycylpeptide N-tetradecanoyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NMT1, NMT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30419 (Start-409)
      • engineered mutation (208)
      • engineered mutation (210)
      • engineered mutation (365-366)
      • engineered mutation (375)
      • engineered mutation (386)
      • engineered mutation (408-409)
    Domains in SCOPe 2.07: d6f56d1
  • Heterogens: MYA, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f56A (A:)
    mgsshhhhhhssglevlfqgphmeeaskrsyqfwdtqpvpklgevvnthgpvepdkdnir
    qepytlpqgftwdaldlgdrgvlkelytllnenyvedddnmfrfdyspefllwalrppgw
    lpqwhcgvrvvssrklvgfisaipanihiydtekkmveinflcvhkklrskrvapvlire
    itrrvhlegifqavytagvvlpkpvgtcqyfhrslnprklievkfshlsrnmtmqrtmkl
    yrlpetpktaglrpmetkdipvvhqlltrylkqfhltpvmsqeevehwfypqeniidtfv
    venangevtdflsfytlpstimnhpthkslkaaysfynvhtqtplldlmsdalvlakmkg
    fdvfnmvdlmenktfveklkfgigdghlqyylynwkcpsmgaekvglvml
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f56A (A:)
    rsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelyt
    llnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanih
    iydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtc
    qyfhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvhqllt
    rylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthk
    slkaaysfynvhtqtplldlmsdalvlakmkgfdvfnmvdlmenktfveklkfgigdghl
    qyylynwkcpsmgaekvglvml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6f56B (B:)
    mgsshhhhhhssglevlfqgphmeeaskrsyqfwdtqpvpklgevvnthgpvepdkdnir
    qepytlpqgftwdaldlgdrgvlkelytllnenyvedddnmfrfdyspefllwalrppgw
    lpqwhcgvrvvssrklvgfisaipanihiydtekkmveinflcvhkklrskrvapvlire
    itrrvhlegifqavytagvvlpkpvgtcqyfhrslnprklievkfshlsrnmtmqrtmkl
    yrlpetpktaglrpmetkdipvvhqlltrylkqfhltpvmsqeevehwfypqeniidtfv
    venangevtdflsfytlpstimnhpthkslkaaysfynvhtqtplldlmsdalvlakmkg
    fdvfnmvdlmenktfveklkfgigdghlqyylynwkcpsmgaekvglvml
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f56B (B:)
    rsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelyt
    llnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanih
    iydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtc
    qyfhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvhqllt
    rylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthk
    slkaaysfynvhtqtplldlmsdalvlakmkgfdvfnmvdlmenktfveklkfgigdghl
    qyylynwkcpsmgaekvglvml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6f56C (C:)
    mgsshhhhhhssglevlfqgphmeeaskrsyqfwdtqpvpklgevvnthgpvepdkdnir
    qepytlpqgftwdaldlgdrgvlkelytllnenyvedddnmfrfdyspefllwalrppgw
    lpqwhcgvrvvssrklvgfisaipanihiydtekkmveinflcvhkklrskrvapvlire
    itrrvhlegifqavytagvvlpkpvgtcqyfhrslnprklievkfshlsrnmtmqrtmkl
    yrlpetpktaglrpmetkdipvvhqlltrylkqfhltpvmsqeevehwfypqeniidtfv
    venangevtdflsfytlpstimnhpthkslkaaysfynvhtqtplldlmsdalvlakmkg
    fdvfnmvdlmenktfveklkfgigdghlqyylynwkcpsmgaekvglvml
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f56C (C:)
    rsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelyt
    llnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanih
    iydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtc
    qyfhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvhqllt
    rylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthk
    slkaaysfynvhtqtplldlmsdalvlakmkgfdvfnmvdlmenktfveklkfgigdghl
    qyylynwkcpsmgaekvglvml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6f56D (D:)
    mgsshhhhhhssglevlfqgphmeeaskrsyqfwdtqpvpklgevvnthgpvepdkdnir
    qepytlpqgftwdaldlgdrgvlkelytllnenyvedddnmfrfdyspefllwalrppgw
    lpqwhcgvrvvssrklvgfisaipanihiydtekkmveinflcvhkklrskrvapvlire
    itrrvhlegifqavytagvvlpkpvgtcqyfhrslnprklievkfshlsrnmtmqrtmkl
    yrlpetpktaglrpmetkdipvvhqlltrylkqfhltpvmsqeevehwfypqeniidtfv
    venangevtdflsfytlpstimnhpthkslkaaysfynvhtqtplldlmsdalvlakmkg
    fdvfnmvdlmenktfveklkfgigdghlqyylynwkcpsmgaekvglvml
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f56D (D:)
    rsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelyt
    llnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanih
    iydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtc
    qyfhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvhqllt
    rylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthk
    slkaaysfynvhtqtplldlmsdalvlakmkgfdvfnmvdlmenktfveklkfgigdghl
    qyylynwkcpsmgaekvglvml