PDB entry 6f55

View 6f55 on RCSB PDB site
Description: complex structure of pacsin sh3 domain and trpv4 proline rich region
Deposited on 2017-11-30, released 2018-10-03
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pacsin 3
    Species: Gallus gallus [TaxId:9031]
    Gene: Pacsin3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1G1I6 (1-63)
      • initiating methionine (0)
      • expression tag (64-66)
  • Chain 'B':
    Compound: prr
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6F55 (0-14)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6f55A (A:)
mkvpgvrvralydytgqeadelsfkageelmkiseedeqgwckgrlltghvglypanyve
kvglaaa

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6f55B (B:)
tkgpapnpppilkvw