PDB entry 6f54

View 6f54 on RCSB PDB site
Description: crystal structure of ketosteroid isomerase triple variant v88i/l99vd103s
Class: isomerase
Keywords: Isomerase, Ksi
Deposited on 2017-11-30, released 2018-05-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: N/A
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: steroid delta-isomerase
  Species: Pseudomonas putida [TaxId:303]
  Gene: ksi
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07445 (0-124)
    • variant (85)
    • variant (96)
    • variant (100)
  Domains in SCOPe 2.08: d6f54a_
• Chain 'B':
  Compound: steroid delta-isomerase
  Species: Pseudomonas putida [TaxId:303]
  Gene: ksi
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07445 (0-124)
    • variant (85)
    • variant (96)
    • variant (100)
  Domains in SCOPe 2.08: d6f54b_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6f54A (A:)
  lptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqglg
  ggkvracltgpvrashngcgampfriemvwngqpcavdvisvmrfdehgriqtmqaywse
  vnlsv
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6f54B (B:)
  lptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqglg
  ggkvracltgpvrashngcgampfriemvwngqpcavdvisvmrfdehgriqtmqaywse
  vnlsv