PDB entry 6f54

View 6f54 on RCSB PDB site
Description: crystal structure of ketosteroid isomerase triple variant v88i/l99vd103s
Class: isomerase
Keywords: Isomerase, Ksi
Deposited on 2017-11-30, released 2018-05-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: N/A
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445 (0-124)
      • variant (85)
      • variant (96)
      • variant (100)
    Domains in SCOPe 2.08: d6f54a_
  • Chain 'B':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445 (0-124)
      • variant (85)
      • variant (96)
      • variant (100)
    Domains in SCOPe 2.08: d6f54b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f54A (A:)
    lptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqglg
    ggkvracltgpvrashngcgampfriemvwngqpcavdvisvmrfdehgriqtmqaywse
    vnlsv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f54B (B:)
    lptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqglg
    ggkvracltgpvrashngcgampfriemvwngqpcavdvisvmrfdehgriqtmqaywse
    vnlsv